![]() | The "AND" operator is unnecessary -- we include all search terms by default. [details] |
Scholar | Results 1 - 50 of about 116 for HOXA9 and HOXA5. (0.08 seconds) |
Hoxa9 influences the phenotype but not the incidence of Mll-AF9 fusion gene leukemia - Full text - MIT Libraries
AR Kumar, WA Hudson, W Chen, R Nishiuchi, Q Yao, … - Blood, 2004 - dx.doi.org
... Gene expression profiling revealed that expression of Mll-AF9 led to
overexpression of Hoxa5, Hoxa6, Hoxa7, Hoxa9, and Hoxa10. Thus ...
Cited by 9 - Web Search - dx.doi.org - bloodjournal.org - ncbi.nlm.nih.gov
Paralogous mouse Hox genes, Hoxa9, Hoxb9, and Hoxd9, function together to control development of the … - Full text - MIT Libraries
F Chen, MR Capecchi - Developmental Biology, 1999 - dx.doi.org
... WA Hudson, W. Chen, R. Nishiuchi, Q. Yao, and JH Kersey Hoxa9 influences the ... A. Tamori,
M. Vali, K. Zeller, D. Korz, and S. Sukumar HOXA5 Regulates Expression ...
Cited by 30 - Web Search - pnas.org - pubmedcentral.nih.gov - mammary.nih.gov - all 7 versions »
Genomic organization of the Hoxa4-Hoxa10 region from Morone saxatilis: implications for Hox gene …
EA Snell, JL Scemama, EJ Stellwag - J. Exp. Zool.(Mol. Dev. Evol.), 1999 - doi.wiley.com
... 3). Among these vertebrates, the Hoxa4, Hoxa5, Hoxa9, and Hoxa10 genes are
always present, whereas the Hoxa8 gene is absent. However ...
Cited by 14 - Web Search - doi.wiley.com - ncbi.nlm.nih.gov - Get it from MIT Libraries
Progress in Hematology
Y Hayashi - cardenjennings.metapress.com
... HOX genes present on the microarrays have been reported to show significant and
con- sistent differences in expression [13].The genes HOXA9 and HOXA5 were not ...
Web Search
Perturbed thyroid morphology and transient hypothyroidism symptoms in Hoxa5 mutant mice - Full text - MIT Libraries
D Meunier, J Aubin, L Jeannotte - Dev Dyn, 2003 - doi.wiley.com
... Perturbed Thyroid Morphology and Transient Hypothyroidism Symptoms in Hoxa5 Mutant
Mice ... Key words: Hox genes; Hoxa5; thyroid gland development; hypothyroidism ...
Cited by 5 - Web Search - ncbi.nlm.nih.gov
MLL, Hox genes, and leukemia: the plot thickens - Full text - MIT Libraries
JL Hess - Blood, 2004 - bloodjournal.org
... is that Hox genes still are the critical targets; however, MLL fusion proteins
up-regulate multiple Hox genes (including Hoxa5, Hoxa7, Hoxa9, Hoxa10, and Meis1 ...
Web Search
Activation of Stem-Cell Specific Genes by HOXA9 and HOXA10 Homeodomain Proteins in CD34 Human Cord …
CM Ferrell, ST Dorsam, H Ohta, RK Humphries, MK … - stemcells.alphamedpress.org
... that is, mice transplanted with marrow cells overexpressing either HOXA9 or HOXA10
are anemic [6, 27, 33]. Another HOXA cluster member, HOXA5, has also been ...
Web Search - dx.doi.org - stemcells.alphamedpress.org
Meis1-mediated apoptosis is caspase-dependent and can be suppressed by coexpression of HoxA9 in … - Full text - MIT Libraries
PJ Wermuth, AM Buchberg - Blood, 2005 - bloodjournal.org
... NEOPLASIA Meis1-mediated apoptosis is caspase dependent and can be suppressed
by coexpression of HoxA9 in murine and human cell lines. ...
Cited by 3 - Web Search - bloodjournal.org - ncbi.nlm.nih.gov
Protein Kinase C-Mediated Phosphorylation of the Leukemia-Associated HOXA9 Protein Impairs Its DNA … - Full text - MIT Libraries
U Vijapurkar, N Fischbach, W Shen, C Brandts, D … - Mol Cell Biol, 2004 - pubmedcentral.nih.gov
... biological activity (9). In the present study, we find that HOXA9 is phosphorylated ...
The Drosophila SCR protein, which is homologous to HOXA5, is both activated ...
Cited by 1 - Web Search - mcb.asm.org - ncbi.nlm.nih.gov - ncbi.nlm.nih.gov
Expression of HOX Genes in Acute Leukemia Cell Lines with and without MLL Translocations
R Macleod, J Reinhardt, M Zaborski, H Quentmeier, … - Leukemia and Lymphoma, 2004 - ingentaconnect.com
... In primary cells from acute leukemia patients, expression of the genes MEIS1, HOXA5,
HOXA7 and HOXA9 has been reported to be correlated with the occurrence of ...
Web Search
Expression of HOX genes in acute leukemia cell lines with and without MLL translocations
H Quentmeier, WG Dirks, RAF MacLeod, J Reinhardt, … - Leuk Lymphoma, 2004 - dx.doi.org
... In primary cells from acute leukemia patients, expression of the genes MEIS1, HOXA5,
HOXA7 and HOXA9 has been reported to be correlated with the occurrence of ...
Cited by 3 - Web Search - taylorandfrancis.metapress.com - ncbi.nlm.nih.gov - Get it from MIT Libraries
Cellular proliferation and transformation induced by HOXB 4 and HOXB 3 proteins involves cooperation … - Full text - MIT Libraries
J Krosl, S Baban, G Krosl, S Rozenfeld, C Largman, … - Oncogene, 1998 - nature.com
... Intriguingly, over- expression of Hoxa7 and Hoxa9 was detected in a signi®cant ...
Furthermore, it was shown that the YPWM motif of Hoxa5 is essential for the ...
Cited by 34 - Web Search - nature.com - ncbi.nlm.nih.gov
Supplemental materials for: Kumar et al, Vol 103, Issue 5, 1823-1828 - Full text - MIT Libraries
B Kumar… - Blood, 2004 - bloodjournal.org
... of genes. The list selected by the ANOVA included 5 of the Hox genes: Hoxa5,
Hoxa6, Hoxa7, Hoxa9, and Hoxa10. The expression values ...
Cited by 1 - Web Search
Genome-wide analysis of acute myeloid leukemia with normal karyotype reveals a unique pattern of …
S Debernardi, DM Lillington, T Chaplin, S … - Genes Chromosomes and Cancer, 2003 - doi.wiley.com
... by the elevated expression of three HOXA family members, HOXA9, involved in ...
even-skipped ho- meobox 1 (homolog of Drosophila); and HOXA5, jointly overexpressed ...
Cited by 27 - Web Search - ncbi.nlm.nih.gov - Get it from MIT Libraries
Analysis of HOX Homeodomain Proteins and Gene Transcripts in the Epidermis
LG Koemueves, C Largman - now.humanapress.com
... antibodies available from Santa Cruz Biotechnology (scbt@scbt.com): HOXA1 (N-20,
C-20); HOXA2 (N-20, P-20); HOXA5 (N-20); HOXA7 (N-18, G-20); HOXA9 (N-20, A-20 ...
Web Search - journals.humanapress.com - biomed.humanapress.com - ncbi.nlm.nih.gov - Get it from MIT Libraries
Transformation of myeloid progenitors by MLL oncoproteins is dependent on Hoxa 7 and Hoxa 9 - Full text - MIT Libraries
PM Ayton, ML Cleary - Genes & Development, 2003 - genesdev.org
... Multiple Hoxa cluster genes (Hoxa1, Hoxa3, Hoxa5, Hoxa7, Hoxa9, Hoxa10, and Hoxa11)
were consistently expressed in MLL-immortalized MPMP cell lines. ...
Cited by 27 - Web Search - pubmedcentral.nih.gov - dx.doi.org - ncbi.nlm.nih.gov - all 7 versions »
Homeodomain Sequences
SD Subsets, V Plots - pnas.org
... goosecoid, Gsh-1, Gsh-2, GSCL, Gtx, H6, HB9, HB24, HD1, Hesx1, HEX, HOX11L1, HOX11L2,
HOXA1, HOXA2, HOXA3, HOXA4, HOXA5, HOXA6, HOXA7, HOXA9, HOXA10, HOXA11 ...
Web Search
Endothelial Cells Express a Novel, Tumor Necrosis Factor-alpha-regulated Variant of HOXA 9 - Full text - MIT Libraries
CV Patel, R Sharangpani, S Bandyopadhyay, PE … - J Biol Chem, 1999 - jbc.org
... We identified cDNAs of HOXA1, HOXA2, HOXA4, HOXA5, HOXA7, HOXA9, HOXB2,
HOXB4, HOXB6, HOXB7, and an unlinked homeobox gene HLX. ...
Cited by 9 - Web Search - jbc.org - ncbi.nlm.nih.gov - ncbi.nlm.nih.gov
Rapid Generation of de novo Biological Pathways from Large-Scale Gene Expression Data Using the …
DC Siu - ingenuity.com
... PBX1,TR ALPHA, Malic Enzyme, HOXA9, HOXA11, HOXD12, HOXB13, SST, RB1, E2F1, HOXA10 ...
TR ALPHA, HOXB7,TCF3, HOXB8, HOXC8, HOXA5, HOXD10, REN, HOXB3, HOXA3, HOXD3 ...
View as HTML - Web Search
Homeobox genes and gut development - Full text - MIT Libraries
F Beck, F Tata, K Chawengsaksophak - BioEssays, 2000 - doi.wiley.com
... Hoxa4 (74) Hoxa5 (23) Hoxc5 (23) hi Hoxb6 (25) Hoxc6 (25) Hoxa7 (25) j [Hoxa9
(29,30) Hoxc9 (30)] n Hoxb8 (25) j Hoxc8 (25) Hoxd8 (25) Hoxc9 (25) or ...
Cited by 33 - Web Search - dx.doi.org - gutjnl.com - gut.bmjjournals.com - all 8 versions »
Molecular Cytogenetics A new recurrent inversion, inv (7)(p15q34), leads to transcriptional …
F Speleman, B Cauwelier, N Dastugue, J Cools, B … - Leukemia, 2005 - nature.com
... 163M21 or RP11-1025G19, we assume that the most probable position of the 7p15
breakpoint is within a 20 kb segment located between HOXA5 and HOXA9 (Figure 2). ...
Web Search - nature.com
HOX genes: not just myeloid oncogenes any more.
HJ Lawrence, NA Fischbach, C Largman - Leukemia, 2005 - nature.com
... The transcriptome of the leukemogenic homeoprotein HOXA9 in human hematopoietic
cells ... Compromised HOXA5 function can limit p53 expression in human breast tumours ...
Web Search - ncbi.nlm.nih.gov - Get it from MIT Libraries
A new recurrent inversion, inv (7)(p15q34), leads to transcriptional activation of
F Speleman, B Cauwelier, N Dastugue, J Cools, B … - Leukemia, 2005 - nature.com
... 163M21 or RP11-1025G19, we assume that the most probable position of the 7p15
breakpoint is within a B20 kb segment located between HOXA5 and HOXA9 (Figure 2 ...
Cited by 1 - Web Search - ncbi.nlm.nih.gov - Get it from MIT Libraries
Altered HOX and WNT 7 A expression in human lung cancer - Full text - MIT Libraries
R Calvo, J West, W Franklin, P Erickson, L Bemis, … - Proceedings of the National Academy of Sciences - pnas.org
... deletion of -catenin in the mesothelioma, NCI-H28, associated with reduced WNT7a
and the lowest overall cell line expression of HOXA1, HOXA7, HOXA9, and HOXA10 ...
Cited by 28 - Web Search - pubmedcentral.nih.gov - dx.doi.org - ncbi.nlm.nih.gov - all 7 versions »
Evolutionary Conservation of Regulatory Elements in Vertebrate Hox Gene Clusters - Full text - MIT Libraries
S Santini, JL Boore, A Meyer - Genome Research, 2003 - genome.org
... HoxA10 ) into the analysis, only the length of the HoxA4 to HoxA9 portion of ... The
zebrafish A cluster lacks the HoxA1 and HoxA3 , HoxA4 , HoxA5 , and HoxA7 genes ...
Cited by 37 - Web Search - evolutionsbiologie.uni-konstanz.de - repositories.cdlib.org - dx.doi.org - all 13 versions »
Differentiation phenotypes of pancreatic islet beta-and alpha-cells are closely related with … - Full text - MIT Libraries
N Mizusawa, T Hasegawa, I Ohigashi, C Tanaka- … - Gene, 2004 - ncbi.nlm.nih.gov
... Cdx2, Gbx2, Pax4, and Hlxb9 genes in MIN6 was higher than those in alpha TC1.6,
while expression of Hoxa2, Hoxa3, Hoxa5, Hoxa6, Hoxa7, Hoxa9, Hoxa10, Hoxa13 ...
Cited by 3 - Web Search - ncbi.nlm.nih.gov
Hox cluster organization in the jawless vertebratePetromyzon marinus - Full text - MIT Libraries
A Force, A Amores, JH Postlethwait - Journal of Experimental Zoology, 2002 - doi.wiley.com
... NP_032294; Hfr HoxA5 AAF44643; Hsa Hox-A5 P20719; Mmu HoxA5 NP_034583; Dre ... HoxA9
P09631; Hsa HoxA9 AAD08713; Mmu HoxD9 NP_038583; HsaHOXD9 CAA33528; Bfl Hox9 ...
Cited by 33 - Web Search - benaroyaresearch.org - benaroyaresearch.org - ncbi.nlm.nih.gov - all 5 versions »
B-cell development in the presence of the MLL/AF4 oncoprotein proceeds in the absence of HOX A7 and …
MC Center - Leukemia, 2003 - nature.com
... Hox7 M97676 Increased expression in BLIN-3 PBX3 X59841 (+4.0) Expressed only in
t(4;11) samples HoxA4 M74297 HoxA5 M26679 HoxA7 AJ005814 HoxA9 U41813 Lineage ...
Web Search - ecu.edu
human lung adenocarcinomas - Full text - MIT Libraries
M Shiraishi, A Sekiguchi, AJ Oates, MJ Terry, Y … - Oncogene, 2002 - nature.com
... HOXA5 AC004080 16 365 ± 17 453 17 056 ± 17 353 GGGTACGACTTCGAATCACG 100 ... HOXA9 a
AC004080 42 705 ± 43 419 42 612 ± 43 832 ACCCTACCTGCTGTGACCAG 94 ...
Cited by 7 - Web Search - nature.com - ncbi.nlm.nih.gov
Regulation of HoxA expression in developing and regenerating axolotl limbs - Full text - MIT Libraries
DM Gardiner, B Blumberg, Y Komine, SV Bryant - Development, 1995 - dev.biologists.org
... HoxA5 3 − 3 RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKEH HoxA7
4 − 4 TRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKIN HoxA9 12 ...
Cited by 56 - Web Search - blumberg-serv.bio.uci.edu - dev.biologists.org - ncbi.nlm.nih.gov
Implication des genes Hox dans les processus d’organogenese chez les mammiferes
J Aubin, L Jeannotte - Medecine/Sciences, 2001 - ist.inserm.fr
... L’analyse des souris déficientes pour Hoxa5 montre qu’un même gène Hox peut agir
dans plusieurs de ces pro- cessus en influençant, entre autres, les ...
Cited by 4 - View as HTML - Web Search
Deregulated homeobox gene expression in cancer: cause or consequence? - Full text - MIT Libraries
C Abate-Shen - Nature Reviews Cancer, 2002 - nature.com
... 8. Chen, F. & Capecchi, MR Paralogous mouse Hox genes, Hoxa9, Hoxb9, and Hoxd9 ...
Compromised HOXA5 function can limit p53 expression in human breast tumours. ...
Cited by 38 - Web Search - nature.com - ncbi.nlm.nih.gov - ncbi.nlm.nih.gov
The pathophysiology of HOX genes and their role in cancer - Full text - MIT Libraries
DG Grier, A Thompson, A Kwasniewska, GJ McGonigle, … - J Pathol, 2005 - doi.wiley.com
... These results suggest that HOXA5 may function as a reg- ulator of haematopoietic ...
Hoxa9 is expressed in CD34 + bone marrow cells and in developing lymphocytes. ...
Cited by 1 - Web Search - ingentaconnect.com - ncbi.nlm.nih.gov
The Role of C/EBP {varepsilon} in the Terminal Stages of Granulocyte Differentiation - Full text - MIT Libraries
JA Lekstrom-Himes - Stem Cells, 2001 - stemcells.alphamedpress.org
... HoxA9, HoxA10, and HoxA5 are expressed early during myelopoiesis, with aberrant
expression affecting overall granulocyte numbers [25-27]. ...
Cited by 19 - Web Search - dx.doi.org - stemcells.alphamedpress.org - ncbi.nlm.nih.gov - all 5 versions »
Differential Expression of Homeobox Genes in Functionally Distinct CD34 Subpopulations of Human Bone … - Full text - MIT Libraries
G Sauvageau, PM Lansdorp, CJ Eaves, DE Hogge, WH … - Proceedings of the National Academy of Sciences - pnas.org
... U. Vijapurkar, D. Khodabakhsh, B. Pau, H. Bernstein, CM Haqq, C. Largman, and HJ
Lawrence The transcriptome of the leukemogenic homeoprotein HOXA9 in human ...
Cited by 174 - Web Search - pubmedcentral.nih.gov - ncbi.nlm.nih.gov - ncbi.nlm.nih.gov
Complete mutation analysis panel of the 39 humanHOX genes
K Kosaki, R Kosaki, T Suzuki, H Yoshihashi, T … - Teratology, 2002 - doi.wiley.com
... of the following human HOX genes had been annotated in the GenBank database before
the present study: HOXA1, HOXA2, HOXA4, HOXA5, HOXA7, HOXA9, HOXA10, HOXA11 ...
Cited by 7 - Web Search - doi.wiley.com - ncbi.nlm.nih.gov - Get it from MIT Libraries
Evolution of the echinoderm Hox gene cluster
S Long, M Byrne - Evolution and Development, 2001 - blackwell-synergy.com
... HoxA1 (HSU10421), HoxB2 (X16176), HoxB3 (X16175), HoxA4 (M74297), HoxA5 (M26679),
HoxB6 (X58431), HoxA7 (P31268), HoxB8 (X16173), HoxA9 (U41813), HoxA10 (S69029 ...
Cited by 5 - Web Search - ingentaconnect.com - ncbi.nlm.nih.gov - Get it from MIT Libraries
Microarray and serial analysis of gene expression analyses identify known and novel transcripts … - Full text - MIT Libraries
RW Georgantas III, V Tanadve, M Malehorn, S … - Cancer Res, 2004 - cancerres.aacrjournals.org
... Our data with human populations tend to confirm this finding for the equivalent
human genes, eg, HoxA5, HoxA9, Bmi-1, RER, Tyk2, JAM1, API-1, and API-2 ...
Cited by 7 - Web Search - cancerres.aacrjournals.org - ncbi.nlm.nih.gov - ncbi.nlm.nih.gov
Oral Communication Haemostasis and Thrombosis
UK Aberdeen, UK Aberdeen - ingentaconnect.com
Page 1. TUESDAY, 8 APRIL 2003 Oral Communication Haemostasis and Thrombosis
1 122 Plasminogen activators: a feature of normal myeloid ...
Web Search
Class Discovery in Acute Lymphoblastic Leukemia using Gene Expression Analysis
U Einav, U Einav, PEDPE Domany, PEDPE Domany - 2003 - weizmann.ac.il
Page 1. Class Discovery in Acute Lymphoblastic Leukemia using Gene Expression
Analysis Uri Einav Uri Einav Uri Einav Uri Einav M.Sc. ...
Cited by 1 - View as HTML - Web Search - weizmann.ac.il
MONDAY, 7 APRIL 2003
UK Bath - ingentaconnect.com
Page 1. MONDAY, 7 APRIL 2003 Oral Communication Haematological Biology
1 Functional responses to expression of TEL/PDGFbetaR are ...
Web Search
MOLECULAR TARGETS FOR THERAPY (MTT)
J Roche, C Zeng, A Baron, S Gadgil, RM Gemmill, I … - Leukemia, 2004 - nature.com
... the pathogenesis of human leukemia, including translocations that fuse NUP98 with
HOXA9, A11, A13 ... ever, other homeodomain genes, that is, HOXA5, 23 HoxB3 24,25 ...
Web Search
The Kinetic Status of Hematopoietic Stem Cell Subpopulations Underlies a Differential Expression of … - Full text - MIT Libraries
R Manfredini, R Zini, S Salati, M Siena, E … - Stem Cells, 2005 - stemcells.alphamedpress.org
... cells (Fig. 5A ). Among them, HOXA5, HOXA9, HOXA10, HOXB2, HOXB5, Meis1,
and PBX2 are preferentially expressed by CD34 + cells. ...
Web Search - dx.doi.org - stemcells.alphamedpress.org - ncbi.nlm.nih.gov
Multicolor COBRA-FISH analysis of chronic myeloid leukemia reveals novel cryptic balanced …
A Barbouti, B Johansson, M Hoeglund, N Mauritzson, … - Genes Chromosomes and Cancer, 2002 - doi.wiley.com
... no. AC004080) and containing the HOXA4, HOXA5, HOXA6, HOXA7, HOXA9, HOXA10,
HOXA11, HOXA13, and EVX1 genes, were used. For delineation ...
Cited by 6 - Web Search - lu-research.lub.lu.se - ncbi.nlm.nih.gov - ncbi.nlm.nih.gov - Get it from MIT Libraries
Gene expression profiling of pediatric acute myelogenous leukemia - Full text - MIT Libraries
ME Ross, R Mahfouz, M Onciu, HC Liu, X Zhou, G … - Blood, 2004 - bloodjournal.org
... these are genes that are expressed in the majority of MLL chimeric fusion
gene–containing cases, including MBNL1, MEIS1, HOXA4, HOXA5, HOXA9 HOXA10, and MYH9 ...
Cited by 8 - Web Search - bloodjournal.org - dx.doi.org - ncbi.nlm.nih.gov
Full Article - Full text - MIT Libraries
FR Goodman, PJ Scambler - Clinical Genetics, 2001 - blackwell-synergy.com
... in leukaemogenesis [59,60], and co-activation of MEIS1 and HOXA9 may be ... Interestingly,
HOXA5 has recently been shown to activate transcription of the key ...
Web Search - blackwell-synergy.com
HOXA genes are included in genetic and biologic networks defining human acute T-cell leukemia (T-ALL … - Full text - MIT Libraries
J Soulier, E Clappier, JM Cayuela, A Regnault, M … - Blood, 2005 - bloodjournal.org
... The genes that mainly define this cluster are HOXA5, HOXA9, HOXA10, and LRIG1, and
accordingly, this subgroup of samples was provisionally named the "HOXA ...
Web Search - bloodjournal.org - ncbi.nlm.nih.gov
Homeobox genes: a molecular link between development and cancer
I PhD, II Dentist, TIIID Student - scielo.br
... malignant transformation, may be primarily due to lack of expression of HOXA5 29 . ...
fusion in frame between the nucleoporin gene NUP98 and the HOXA9 gene was ...
Cached - Web Search - scielo.br
Hox regulation of normal and leukemic hematopoietic stem cells.
C Abramovich, RK Humphries - Current Opinion in Hematology, 2005 - co-hematology.com
... Hoxa9 and Hoxa7; however, Mll-AF9 can induce leukemia in mice lacking Hoxa9. ... leukemia
and propose that the 'Hox code' minimally defined by the Hoxa5-a9 cluster ...
Web Search - ncbi.nlm.nih.gov - Get it from MIT Libraries
Estrogen-dependent E2a/Pbx1 myeloid cell lines exhibit conditional differentiation that can be … - Full text - MIT Libraries
DB Sykes, MP Kamps - Blood, 2001 - bloodjournal.org
... 33 no expression of Hoxa5, Hoxa7, or Hoxa9 was detected in progenitors, though each
transcript was clearly observed in NIH3T3 fibroblasts (data not shown). ...
Cited by 10 - Web Search - bloodjournal.org - bloodjournal.org - ncbi.nlm.nih.gov - all 5 versions »
|
©2005 Google